PDB entry 1s04

View 1s04 on RCSB PDB site
Description: Solution NMR Structure of Protein PF0455 from Pyrococcus furiosus. Northeast Structural Genomics Consortium Target PfR13
Class: Structural genomics, unknown function
Keywords: Structural genomics, NMR, PfR13, PF0455, Reduced-dimensionality, GFT, Northeast Structural Genomics Consortium, NESG, protein structure initiative, PSI, unknown function
Deposited on 2003-12-29, released 2005-01-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PF0455
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF0455
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1s04a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1s04A (A:)
mewemglqeefleliklrkkkiegrlydekrrqikpgdvisfeggklkvrvkairvynsf
remlekeglenvlpgvksieegiqvyrrfydeekekkygvvaieiepley