PDB entry 1s03

View 1s03 on RCSB PDB site
Description: The Structure of a Ribosomal Protein S8/spc Operon mRNA Complex
Class: transcription/RNA
Keywords: protein-RNA complex, ribosomal, spc operon, TRANSCRIPTION-RNA COMPLEX
Deposited on 2003-12-29, released 2004-05-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.237
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 47-mer
    Species: synthetic, synthetic
    Gene:
  • Chain 'B':
    Compound: 47-mer
    Species: synthetic, synthetic
    Gene:
  • Chain 'G':
    Compound: 30S ribosomal protein S8
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1s03g_
  • Chain 'H':
    Compound: 30S ribosomal protein S8
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1s03h_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1s03G (G:)
    smqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelel
    tlkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqagl
    ggeiicyva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s03G (G:)
    dpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpeleltlk
    yfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglgge
    iicyva
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1s03H (H:)
    smqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelel
    tlkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqagl
    ggeiicyva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s03H (H:)
    qdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpeleltl
    kyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglgg
    eiicyva