PDB entry 1rzw

View 1rzw on RCSB PDB site
Description: The Solution Structure of the Archaeglobus fulgidis protein AF2095. Northeast Structural Genomics Consortium target GR4
Class: Structural Genomics, Unknown function
Keywords: Beta-sheet of 4 parallel, anti-parallel beta-strands and 3 alpha-helices, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Unknown function
Deposited on 2003-12-29, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein AF2095(GR4)
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF2095
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28185 (0-114)
      • expression tag (115-122)
    Domains in SCOPe 2.07: d1rzwa1, d1rzwa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rzwA (A:)
    mtlkqvivvrddlklsrgklavqvahaaiigylksdsslrrkwldegqkkvvlkvkslee
    llgikhkaeslglvtglvqdagltevppgtitavvigpdeerkidkvtgnlpllklehhh
    hhh