PDB entry 1rzs

View 1rzs on RCSB PDB site
Description: Solution structure of P22 Cro
Class: transcription
Keywords: helix-turn-helix, DNA-binding protein, structural evolution, transcription
Deposited on 2003-12-28, released 2004-06-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: regulatory protein cro
    Species: Enterobacteria phage P22 [TaxId:10754]
    Gene: cro
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1rzsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rzsA (A:)
    mykkdvidhfgtqravakalgisdaavsqwkevipekdayrleivtagalkyqenayrqa
    a