PDB entry 1rzs

View 1rzs on RCSB PDB site
Description: solution structure of p22 cro
Deposited on 2003-12-28, released 2004-06-01
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-01, with a file datestamp of 2004-06-01.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1rzsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rzsA (A:)
    mykkdvidhfgtqravakalgisdaavsqwkevipekdayrleivtagalkyqenayrqa
    a