PDB entry 1rzr

View 1rzr on RCSB PDB site
Description: crystal structure of transcriptional regulator-phosphoprotein-DNA complex
Deposited on 2003-12-27, released 2004-10-12
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-12, with a file datestamp of 2004-10-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.242
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rzrA (A:)
    mnvtiydvareasvsmatvsrvvngnpnvkpstrkkvletierlgyrpnavarglaskkt
    ttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdgi
    ifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkni
    afvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekp
    taifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigav
    amrlltkymnketvdssivqlphriefrqstk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rzrC (C:)
    mnvtiydvareasvsmatvsrvvngnpnvkpstrkkvletierlgyrpnavarglaskkt
    ttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdgi
    ifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkni
    afvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekp
    taifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigav
    amrlltkymnketvdssivqlphriefrqstk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rzrD (D:)
    mnvtiydvareasvsmatvsrvvngnpnvkpstrkkvletierlgyrpnavarglaskkt
    ttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdgi
    ifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkni
    afvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekp
    taifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigav
    amrlltkymnketvdssivqlphriefrqstk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rzrG (G:)
    mnvtiydvareasvsmatvsrvvngnpnvkpstrkkvletierlgyrpnavarglaskkt
    ttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdgi
    ifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkni
    afvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedekp
    taifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydigav
    amrlltkymnketvdssivqlphriefrqstk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1rzrL (L:)
    maqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgat
    itisaegsdeadalaaledtmskeglge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzrL (L:)
    aqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgati
    tisaegsdeadalaaledtmskeglge
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1rzrS (S:)
    maqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgat
    itisaegsdeadalaaledtmskeglge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzrS (S:)
    aqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgati
    tisaegsdeadalaaledtmskeglge
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1rzrT (T:)
    maqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgat
    itisaegsdeadalaaledtmskeglge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzrT (T:)
    aqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgati
    tisaegsdeadalaaledtmskeglge
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1rzrY (Y:)
    maqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgat
    itisaegsdeadalaaledtmskeglge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzrY (Y:)
    aqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgati
    tisaegsdeadalaaledtmskeglge