PDB entry 1rzp

View 1rzp on RCSB PDB site
Description: Crystal Structure of C-Terminal Despentapeptide Nitrite Reductase from Achromobacter Cycloclastes at pH6.2
Class: oxidoreductase
Keywords: denitrification, residue deletion, pH profile, Greek key beta barrel
Deposited on 2003-12-26, released 2004-03-30
The last revision prior to the SCOP 1.75 freeze date was dated 2004-04-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Achromobacter cycloclastes
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rzpa1, d1rzpa2
  • Chain 'B':
    Compound: Copper-containing nitrite reductase
    Species: Achromobacter cycloclastes
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rzpb1, d1rzpb2
  • Chain 'C':
    Compound: Copper-containing nitrite reductase
    Species: Achromobacter cycloclastes
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rzpc1, d1rzpc2
  • Heterogens: CU, SO4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rzpA (A:)
    aagaapvdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteih
    amtfngsvpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeet
    tlrfkatkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvge
    qdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavger
    vlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgv
    yayvnhnlieafelgaaghfkvtgewnddlmtsvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzpA (A:)
    distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
    vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
    kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvgeqdfyvpk
    deagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavgervlvvhsq
    anrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgvyayvnhn
    lieafelgaaghfkvtgewnddlmtsvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rzpB (B:)
    aagaapvdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteih
    amtfngsvpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeet
    tlrfkatkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvge
    qdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavger
    vlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgv
    yayvnhnlieafelgaaghfkvtgewnddlmtsvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzpB (B:)
    distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
    vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
    kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvgeqdfyvpk
    deagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavgervlvvhsq
    anrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgvyayvnhn
    lieafelgaaghfkvtgewnddlmtsvv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rzpC (C:)
    aagaapvdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteih
    amtfngsvpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeet
    tlrfkatkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvge
    qdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavger
    vlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgv
    yayvnhnlieafelgaaghfkvtgewnddlmtsvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzpC (C:)
    aapvdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamt
    fngsvpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlr
    fkatkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvgeqdf
    yvpkdeagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavgervlv
    vhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgvyay
    vnhnlieafelgaaghfkvtgewnddlmtsvv