PDB entry 1rzm

View 1rzm on RCSB PDB site
Description: Crystal structure of 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHPS) from Thermotoga maritima complexed with Cd2+, PEP and E4P
Class: transferase
Keywords: (beta/alpha) barrel, tim barrel, transferase
Deposited on 2003-12-24, released 2004-08-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.219
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: AROF, TM0343
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rzma_
  • Chain 'B':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: AROF, TM0343
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rzmb_
  • Heterogens: CD, PEP, E4P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rzmA (A:)
    mivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfesldcve
    svvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflsel
    gvkvlrggaykprtspysfqglgekgleylreaadkygmyvvtealgeddlpkvaeyadi
    iqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergir
    tfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevh
    pepekalsdgkqsldfelfkelvqemkkladalgvkvn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rzmB (B:)
    mivvlkpgsteedirkvvklaesynlkchiskgqertvigiigddryvvadkfesldcve
    svvrvlkpyklvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflsel
    gvkvlrggaykprtspysfqglgekgleylreaadkygmyvvtealgeddlpkvaeyadi
    iqigarnaqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergir
    tfekatrntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevh
    pepekalsdgkqsldfelfkelvqemkkladalgvkvn