PDB entry 1rzi

View 1rzi on RCSB PDB site
Description: Crystal structure of human anti-HIV-1 gp120-reactive antibody 47e fab
Class: immune system
Keywords: HIV-1; gp120; CD4i; antibodies; tyrosine sulfation; VH-gene usage, IMMUNE SYSTEM
Deposited on 2003-12-24, released 2004-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.233
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab 47e light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZI (Start-211)
    Domains in SCOPe 2.07: d1rzia1, d1rzia2
  • Chain 'B':
    Compound: Fab 47e heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZI (0-End)
    Domains in SCOPe 2.07: d1rzib1, d1rzib2
  • Chain 'C':
    Compound: Fab 47e light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZI (0-211)
    Domains in SCOPe 2.07: d1rzic1, d1rzic2
  • Chain 'D':
    Compound: Fab 47e heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZI (0-End)
    Domains in SCOPe 2.07: d1rzid1, d1rzid2
  • Chain 'E':
    Compound: Fab 47e light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZI (Start-211)
    Domains in SCOPe 2.07: d1rzie1, d1rzie2
  • Chain 'F':
    Compound: Fab 47e heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZI (0-229)
    Domains in SCOPe 2.07: d1rzif1, d1rzif2
  • Chain 'G':
    Compound: Fab 47e light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZI (Start-211)
    Domains in SCOPe 2.07: d1rzig1, d1rzig2
  • Chain 'H':
    Compound: Fab 47e heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZI (0-End)
    Domains in SCOPe 2.07: d1rzih1, d1rzih2
  • Chain 'I':
    Compound: Fab 47e light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZI (Start-211)
    Domains in SCOPe 2.07: d1rzii1, d1rzii2
  • Chain 'J':
    Compound: Fab 47e heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZI (0-End)
    Domains in SCOPe 2.07: d1rzij1, d1rzij2
  • Chain 'K':
    Compound: Fab 47e light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZI (Start-211)
    Domains in SCOPe 2.07: d1rzik1, d1rzik2
  • Chain 'L':
    Compound: Fab 47e heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZI (0-End)
    Domains in SCOPe 2.07: d1rzil1, d1rzil2
  • Chain 'M':
    Compound: Fab 47e light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZI (Start-211)
    Domains in SCOPe 2.07: d1rzim1, d1rzim2
  • Chain 'N':
    Compound: Fab 47e heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZI (0-End)
    Domains in SCOPe 2.07: d1rzin1, d1rzin2
  • Chain 'O':
    Compound: Fab 47e light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZI (Start-211)
    Domains in SCOPe 2.07: d1rzio1, d1rzio2
  • Chain 'P':
    Compound: Fab 47e heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1RZI (0-End)
    Domains in SCOPe 2.07: d1rzip1, d1rzip2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rziA (A:)
    diqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsr
    fsgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziA (A:)
    iqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsrf
    sgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rziB (B:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakggedgdylsdpfyynhgmdvwg
    qgttvtvasastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziB (B:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakgghgmdvwgqgttvtvasastk
    gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rziC (C:)
    diqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsr
    fsgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rziD (D:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakggedgdylsdpfyynhgmdvwg
    qgttvtvasastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziD (D:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakgghgmdvwgqgttvtvasastk
    gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rziE (E:)
    diqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsr
    fsgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziE (E:)
    iqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsrf
    sgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1rziF (F:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakggedgdylsdpfyynhgmdvwg
    qgttvtvasastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziF (F:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakgghgmdvwgqgttvtvasastk
    gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1rziG (G:)
    diqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsr
    fsgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziG (G:)
    iqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsrf
    sgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rziH (H:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakggedgdylsdpfyynhgmdvwg
    qgttvtvasastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziH (H:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakgghgmdvwgqgttvtvasastk
    gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1rziI (I:)
    diqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsr
    fsgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziI (I:)
    iqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsrf
    sgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1rziJ (J:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakggedgdylsdpfyynhgmdvwg
    qgttvtvasastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziJ (J:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakgghgmdvwgqgttvtvasastk
    gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1rziK (K:)
    diqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsr
    fsgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziK (K:)
    iqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsrf
    sgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1rziL (L:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakggedgdylsdpfyynhgmdvwg
    qgttvtvasastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziL (L:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakghgmdvwgqgttvtvasastkg
    psvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
    ssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1rziM (M:)
    diqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsr
    fsgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziM (M:)
    iqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsrf
    sgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1rziN (N:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakggedgdylsdpfyynhgmdvwg
    qgttvtvasastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziN (N:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakgghgmdvwgqgttvtvasastk
    gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1rziO (O:)
    diqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsr
    fsgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziO (O:)
    iqmtqspslsasvgdrvtitcrasqsissylnwyqqkpgkvpklliyaasslqsgvpsrf
    sgsgsgtdftltisslqpedfatyycqqsystshtfgqgtkleikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1rziP (P:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakggedgdylsdpfyynhgmdvwg
    qgttvtvasastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rziP (P:)
    qvqllqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipvfgsany
    aqkfqgrvtitadeatsttymelsslrsedtavyfcakgghgmdvwgqgttvtvasastk
    gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep