PDB entry 1rzg

View 1rzg on RCSB PDB site
Description: Crystal structure of Human anti-HIV-1 GP120 reactive antibody 412d
Deposited on 2003-12-24, released 2004-02-03
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-16, with a file datestamp of 2004-03-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rzgA (A:)
    evqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahy
    aqrfqgrvsitadeststaymelsslrsedtavfycaspypndyndyapeegmswyfdlw
    grgtlvtvspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgv
    htfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzgA (A:)
    evqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahy
    aqrfqgrvsitadeststaymelsslrsedtavfycaspypndygmswyfdlwgrgtlvt
    vspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rzgB (B:)
    diqmtqspstlsasvgdrvtitcrasqsisnwlawyqqkpgrapkllmykasslksgvps
    rfsgsgsgteftltisslqsddfatyycqqhdsspytfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhklyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzgB (B:)
    diqmtqspstlsasvgdrvtitcrasqsisnwlawyqqkpgrapkllmykasslksgvps
    rfsgsgsgteftltisslqsddfatyycqqhdsspytfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhklyacevthqglsspvtksfnrge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rzgC (C:)
    evqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahy
    aqrfqgrvsitadeststaymelsslrsedtavfycaspypndyndyapeegmswyfdlw
    grgtlvtvspastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgv
    htfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzgC (C:)
    vqlvqsgaevkkpgssvkvsckasggtfsnyainwvrqapgqglewmggiipifniahya
    qrfqgrvsitadeststaymelsslrsedtavfycaspypndygmswyfdlwgrgtlvtv
    spastkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rzgD (D:)
    diqmtqspstlsasvgdrvtitcrasqsisnwlawyqqkpgrapkllmykasslksgvps
    rfsgsgsgteftltisslqsddfatyycqqhdsspytfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhklyacevthqglsspvtksfnrgec