PDB entry 1rzf

View 1rzf on RCSB PDB site
Description: Crystal structure of Human anti-HIV-1 GP120-reactive antibody E51
Class: immune system
Keywords: HIV-1; gp120; CD4i; antibodies; tyrosine sulfation; VH-gene usage
Deposited on 2003-12-24, released 2004-02-03
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab E51 heavy chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d1rzfh1, d1rzfh2
  • Chain 'L':
    Compound: Fab E51 light chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d1rzfl1, d1rzfl2
  • Heterogens: GOL, IPA, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rzfH (H:)
    evqlvqsgaevnkpgssvkvscqasgatlnshafswvrqapgqglewmagiipifgsshy
    aqkfrgrvtisadestrtvylhlrglrsddtavyycasnsiagvaaagdyadydggyyyd
    mdvwgqgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgal
    tsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rzfH (H:)
    vqlvqsgaevnkpgssvkvscqasgatlnshafswvrqapgqglewmagiipifgsshya
    qkfrgrvtisadestrtvylhlrglrsddtavyycasnsiaggyyydmdvwgqgttvtvs
    sastkgpsvfplaptsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkrvepk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rzfL (L:)
    qsiltqppsvsaapgqkvtiscsgsssnignndvswyqqfpgtvpklviyennerpsgip
    drfsgsksgtsatlgitglqtgdeadyycgtwdsslsavvfgggskvtvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvapt