PDB entry 1rz8

View 1rz8 on RCSB PDB site
Description: crystal structure of human anti-hiv-1 gp120-reactive antibody 17b
Class: immune system
Keywords: HIV-1; gp120; CD4i; antibodies; tyrosine sulfation; VH-gene usage
Deposited on 2003-12-24, released 2004-02-03
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.212
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab 17b light chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d1rz8a1, d1rz8a2
  • Chain 'B':
    Compound: Fab 17b heavy chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d1rz8b1, d1rz8b2
  • Chain 'C':
    Compound: Fab 17b light chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d1rz8c1, d1rz8c2
  • Chain 'D':
    Compound: Fab 17b heavy chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d1rz8d1, d1rz8d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rz8A (A:)
    divmtqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa
    rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rz8B (B:)
    evqlvesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy
    aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeydnngflkhwgq
    gtlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvht
    fpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rz8C (C:)
    divmtqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa
    rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rz8D (D:)
    evqlvesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy
    aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeydnngflkhwgq
    gtlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvht
    fpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep