PDB entry 1rz8

View 1rz8 on RCSB PDB site
Description: crystal structure of human anti-hiv-1 gp120-reactive antibody 17b
Deposited on 2003-12-24, released 2004-02-03
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-16, with a file datestamp of 2004-03-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.212
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rz8A (A:)
    divmtqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa
    rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rz8B (B:)
    evqlvesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy
    aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeydnngflkhwgq
    gtlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvht
    fpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rz8C (C:)
    divmtqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa
    rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rz8D (D:)
    evqlvesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy
    aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeydnngflkhwgq
    gtlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvht
    fpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep