PDB entry 1rz7

View 1rz7 on RCSB PDB site
Description: crystal structure of human anti-hiv-1 gp120-reactive antibody 48d
Deposited on 2003-12-24, released 2004-02-03
The last revision prior to the SCOP 1.71 freeze date was dated 2004-03-16, with a file datestamp of 2004-03-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.201
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rz7H (H:)
    evqlvqsgaevkkpgatvkisckasgytfsdfymywvrqapgkglewmglidpedadtmy
    aekfrgrvtitadtstdtgylelsslrsedtavyycaadpwelnafnvwgqgtlvsvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1rz7L (L:)
    diqmtqspssvsasvgdrvtitcrasqdistwlawyqqkpgkapklliyaastlqsgvps
    rfsgsgsgtdfsltinslqpedfatyycqqansfftfgggtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhklyacevthqglsspvtksfnrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz7L (L:)
    iqmtqspssvsasvgdrvtitcrasqdistwlawyqqkpgkapklliyaastlqsgvpsr
    fsgsgsgtdfsltinslqpedfatyycqqansfftfgggtkveikrtvaapsvfifppsd
    eqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhklyacevthqglsspvtksfnrge