PDB entry 1rz5

View 1rz5 on RCSB PDB site
Description: Di-haem Cytochrome c Peroxidase, Form OUT
Class: oxidoreductase
Keywords: oxidoreductase; peroxidase; haem; electron transport
Deposited on 2003-12-24, released 2004-06-29
The last revision prior to the SCOP 1.75 freeze date was dated 2004-06-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.186
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Marinobacter hydrocarbonoclasticus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rz5a1, d1rz5a2
  • Heterogens: CA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rz5A (A:)
    dnlmeransmfepipkyppvidgneltqakvelgkmeffeprlssshliscntchnvglg
    gddelptsighgwqkgprnsptvfnavfnaaqfwdgraadlaeqakgpvqagvemsstpd
    rvvatlksmpeyierfedafpgqenpvtfdnmavaieayeatlitpeapfdkylrgdtsa
    lnesekeglalfmdrgctachsgvnlggqnyypfglvakpgaeilpegdkgrfsvtetas
    deyvfrasplrnieltapyfhsgavwsleeavavmgtaqlgtelnndevksivaflktlt
    gnvpevtypvlppstantpkpvdmip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz5A (A:)
    dnlmeransmfepipkyppvidgneltqakvelgkmeffeprlssshliscntchnvglg
    gddelptsighgwqkgprnsptvfnavfnaaqfwdgrakgpvqagvemsstpdrvvatlk
    smpeyierfedafpgqenpvtfdnmavaieayeatlitpeapfdkylrgdtsalneseke
    glalfmdrgctachsgvnlggqnyypfglvakkgrfsvtetasdeyvfrasplrnielta
    pyfhsgavwsleeavavmgtaqlgtelnndevksivaflktltgnvpevtypvlppstan
    tpkpvdmip