PDB entry 1rz2

View 1rz2 on RCSB PDB site
Description: 1.6A crystal structure of the protein BA4783/Q81L49 (similar to sortase B) from Bacillus anthracis.
Class: structural genomics, unknown function
Keywords: Sortase B protein, B. anthracis, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2003-12-23, released 2004-07-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.225
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein BA4783
    Species: Bacillus anthracis [TaxId:198094]
    Gene: BA4783
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rz2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rz2A (A:)
    mssekerkkkiffqriltvvflgtffysvyelgdifmdyyenrkvmaeaqniyekspmee
    qsqdgevrkqfkalqqinqeivgwitmddtqinypivqakdndyylfrnykgedmragsi
    fmdyrndvksqnrntilyghrmkdgsmfgslkkmldeeffmshrklyydtlfegydlevf
    svyttttdfyyietdfssdteytsflekiqekslyktdttvtagdqivtlstcdyaldpe
    agrlvvhaklvkrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz2A (A:)
    ifmdyyenrkvmaeaqniyekspmeeqsqdgevrkqfkalqqinqeivgwitmddtqiny
    pivqakdndyylfrnykgedmragsifmdyrndvksqnrntilyghrmkdgsmfgslkkm
    ldeeffmshrklyydtlfegydlevfsvyttttdfyyietdfssdteytsflekiqeksl
    yktdttvtagdqivtlstcdagrlvvhaklvkrq