PDB entry 1rz1

View 1rz1 on RCSB PDB site
Description: Reduced flavin reductase PheA2 in complex with NAD
Class: oxidoreductase
Keywords: flavin, NAD, OXIDOREDUCTASE
Deposited on 2003-12-23, released 2004-04-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.237
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenol 2-hydroxylase component B
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LAG2 (0-End)
      • modified residue (0)
      • modified residue (9)
      • modified residue (30)
      • modified residue (36)
      • modified residue (55)
      • modified residue (79)
    Domains in SCOPe 2.05: d1rz1a_
  • Chain 'B':
    Compound: phenol 2-hydroxylase component B
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LAG2 (0-End)
      • modified residue (0)
      • modified residue (9)
      • modified residue (30)
      • modified residue (36)
      • modified residue (55)
      • modified residue (79)
    Domains in SCOPe 2.05: d1rz1b_
  • Chain 'C':
    Compound: phenol 2-hydroxylase component B
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LAG2 (0-End)
      • modified residue (0)
      • modified residue (9)
      • modified residue (30)
      • modified residue (36)
      • modified residue (55)
      • modified residue (79)
    Domains in SCOPe 2.05: d1rz1c_
  • Chain 'D':
    Compound: phenol 2-hydroxylase component B
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LAG2 (0-End)
      • modified residue (0)
      • modified residue (9)
      • modified residue (30)
      • modified residue (36)
      • modified residue (55)
      • modified residue (79)
    Domains in SCOPe 2.05: d1rz1d_
  • Chain 'E':
    Compound: phenol 2-hydroxylase component B
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LAG2 (0-End)
      • modified residue (0)
      • modified residue (9)
      • modified residue (30)
      • modified residue (36)
      • modified residue (55)
      • modified residue (79)
    Domains in SCOPe 2.05: d1rz1e_
  • Chain 'F':
    Compound: phenol 2-hydroxylase component B
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LAG2 (0-End)
      • modified residue (0)
      • modified residue (9)
      • modified residue (30)
      • modified residue (36)
      • modified residue (55)
      • modified residue (79)
    Domains in SCOPe 2.05: d1rz1f_
  • Chain 'G':
    Compound: phenol 2-hydroxylase component B
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LAG2 (0-End)
      • modified residue (0)
      • modified residue (9)
      • modified residue (30)
      • modified residue (36)
      • modified residue (55)
      • modified residue (79)
    Domains in SCOPe 2.05: d1rz1g_
  • Chain 'H':
    Compound: phenol 2-hydroxylase component B
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LAG2 (0-End)
      • modified residue (0)
      • modified residue (9)
      • modified residue (30)
      • modified residue (36)
      • modified residue (55)
      • modified residue (79)
    Domains in SCOPe 2.05: d1rz1h_
  • Heterogens: FAD, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rz1A (A:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz1A (A:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rz1B (B:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz1B (B:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rz1C (C:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz1C (C:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rz1D (D:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz1D (D:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rz1E (E:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz1E (E:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1rz1F (F:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz1F (F:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1rz1G (G:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz1G (G:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rz1H (H:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz1H (H:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq