PDB entry 1rz1

View 1rz1 on RCSB PDB site
Description: reduced flavin reductase phea2 in complex with nad
Deposited on 2003-12-23, released 2004-04-06
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.237
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1rz1a_
  • Chain 'B':
    Domains in SCOP 1.67: d1rz1b_
  • Chain 'C':
    Domains in SCOP 1.67: d1rz1c_
  • Chain 'D':
    Domains in SCOP 1.67: d1rz1d_
  • Chain 'E':
    Domains in SCOP 1.67: d1rz1e_
  • Chain 'F':
    Domains in SCOP 1.67: d1rz1f_
  • Chain 'G':
    Domains in SCOP 1.67: d1rz1g_
  • Chain 'H':
    Domains in SCOP 1.67: d1rz1h_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rz1A (A:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz1A (A:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rz1B (B:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz1B (B:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rz1C (C:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz1C (C:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rz1D (D:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz1D (D:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rz1E (E:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz1E (E:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1rz1F (F:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz1F (F:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1rz1G (G:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz1G (G:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rz1H (H:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz1H (H:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq