PDB entry 1rz0

View 1rz0 on RCSB PDB site
Description: Flavin reductase PheA2 in native state
Class: oxidoreductase
Keywords: flavin, FAD, OXIDOREDUCTASE
Deposited on 2003-12-23, released 2004-04-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.222
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenol 2-hydroxylase component B
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LAG2 (0-End)
      • modified residue (0)
      • modified residue (9)
      • modified residue (30)
      • modified residue (36)
      • modified residue (55)
      • modified residue (79)
    Domains in SCOPe 2.05: d1rz0a_
  • Chain 'B':
    Compound: phenol 2-hydroxylase component B
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LAG2 (0-End)
      • modified residue (0)
      • modified residue (9)
      • modified residue (30)
      • modified residue (36)
      • modified residue (55)
      • modified residue (79)
    Domains in SCOPe 2.05: d1rz0b_
  • Chain 'C':
    Compound: phenol 2-hydroxylase component B
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LAG2 (0-End)
      • modified residue (0)
      • modified residue (9)
      • modified residue (30)
      • modified residue (36)
      • modified residue (55)
      • modified residue (79)
    Domains in SCOPe 2.05: d1rz0c_
  • Chain 'D':
    Compound: phenol 2-hydroxylase component B
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LAG2 (0-End)
      • modified residue (0)
      • modified residue (9)
      • modified residue (30)
      • modified residue (36)
      • modified residue (55)
      • modified residue (79)
    Domains in SCOPe 2.05: d1rz0d_
  • Chain 'E':
    Compound: phenol 2-hydroxylase component B
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LAG2 (0-End)
      • modified residue (0)
      • modified residue (9)
      • modified residue (30)
      • modified residue (36)
      • modified residue (55)
      • modified residue (79)
    Domains in SCOPe 2.05: d1rz0e_
  • Chain 'F':
    Compound: phenol 2-hydroxylase component B
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LAG2 (0-End)
      • modified residue (0)
      • modified residue (9)
      • modified residue (30)
      • modified residue (36)
      • modified residue (55)
      • modified residue (79)
    Domains in SCOPe 2.05: d1rz0f_
  • Chain 'G':
    Compound: phenol 2-hydroxylase component B
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LAG2 (0-End)
      • modified residue (0)
      • modified residue (9)
      • modified residue (30)
      • modified residue (36)
      • modified residue (55)
      • modified residue (79)
    Domains in SCOPe 2.05: d1rz0g_
  • Chain 'H':
    Compound: phenol 2-hydroxylase component B
    Species: Geobacillus thermoglucosidasius [TaxId:1426]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LAG2 (0-End)
      • modified residue (0)
      • modified residue (9)
      • modified residue (30)
      • modified residue (36)
      • modified residue (55)
      • modified residue (79)
    Domains in SCOPe 2.05: d1rz0h_
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rz0A (A:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz0A (A:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rz0B (B:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz0B (B:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rz0C (C:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz0C (C:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rz0D (D:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz0D (D:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rz0E (E:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz0E (E:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1rz0F (F:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz0F (F:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1rz0G (G:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz0G (G:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rz0H (H:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaqnekvetss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rz0H (H:)
    mddrlfrnamgkfatgvtvittelngavhgmtanafmsvslnpklvlvsigekakmleki
    qqskkyavnilsqdqkvlsmnfagqlekpvdvqfeelgglpvikdalaqiscqvvnevqa
    gdhtlfigevtdikiteqdpllffsgkyhqlaq