PDB entry 1ryx

View 1ryx on RCSB PDB site
Description: Crystal structure of hen serum transferrin in apo- form
Class: metal transport
Keywords: Hen serum transferrin, Apo- form, Domain Orientation, METAL TRANSPORT
Deposited on 2003-12-23, released 2004-07-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.283
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ovotransferrin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1ryxa1, d1ryxa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ryxA (A:)
    appksvirwctisspeekkcnnlrdltqqerisltcvqkatyldcikaianneadaisld
    ggqafeaglapyklkpiaaevyehtegsttsyyavavvkkgteftvndlqgktschtglg
    rsagwnipigtllhrgaiewegiesgsveqavakffsascvpgatieqklcrqckgdpkt
    kcarnapysgysgafhclkdgkgdvafvkhttvnenapdqkdeyellcldgsrqpvdnyk
    tcnwarvaahavvarddnkvediwsflskaqsdfgvdtksdfhlfgppgkkdpvlkdllf
    kdsaimlkrvpslmdsqlylgfeyysaiqsmrkdqltpsprenriqwcavgkdekskcdr
    wsvvsngdvectvvdetkdciikimkgeadavaldgglvytagvcglvpvmaeryddesq
    csktderpasyfavavarkdsnvnwnnlkgkkschtavgrtagwvipmglihnrtgtcnf
    deyfsegcapgsppnsrlcqlcqgsggippekcvasshekyfgytgalrclvekgdvafi
    qhstveentggknkadwaknlqmddfellctdgrranvmdyrecnlaevpthavvvrpek
    ankirdllerqekrfgvngsekskfmmfesqnkdllfkdltkclfkvregttykeflgdk
    fytvisslktcnpsdilqmcsflegk