PDB entry 1ryv

View 1ryv on RCSB PDB site
Description: Three dimensional solution structure of the K27A MUTANT of sodium channels inhibitor HAINANTOXIN-IV BY 2D 1H-NMR
Class: toxin
Keywords: neurotoxin, inhibitor cystine knot motif
Deposited on 2003-12-22, released 2004-01-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hainantoxin-IV
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P83471 (0-34)
    • engineered (26)
  Domains in SCOPe 2.01: d1ryva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ryvA (A:)
  eclgfgkgcnpsndqcckssnlvcsrahrwckyei