PDB entry 1ryt

View 1ryt on RCSB PDB site
Description: rubrerythrin
Deposited on 1996-04-26, released 1997-05-15
The last revision prior to the SCOP 1.57 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.182
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ryt_ (-)
    kslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrlf
    kfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarvf
    asiavaeefhekrfldfarnikegrvflreqatkwrcrncgyvhegtgapelcpacahpk
    ahfellginw