PDB entry 1ryq

View 1ryq on RCSB PDB site
Description: Putative DNA-directed RNA polymerase, subunit e'' from Pyrococcus Furiosus Pfu-263306-001
Class: transferase
Keywords: Structural genomics, RNA polymerase, Zinc, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, TRANSFERASE
Deposited on 2003-12-22, released 2004-08-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.194
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA-directed RNA polymerase, subunit e''
  Species: Pyrococcus furiosus [TaxId:2261]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8U440 (Start-68)
    • expression tag (2-6)
  Domains in SCOPe 2.05: d1ryqa_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1ryqA (A:)
  ahhhhhhgssekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakv
  pgkyairvr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1ryqA (A:)
  hhhhhekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakvpgkya
  irvr