PDB entry 1ryq

View 1ryq on RCSB PDB site
Description: Putative DNA-directed RNA polymerase, subunit e'' from Pyrococcus Furiosus Pfu-263306-001
Class: transferase
Keywords: Structural genomics, RNA polymerase, Zinc, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, TRANSFERASE
Deposited on 2003-12-22, released 2004-08-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.194
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase, subunit e''
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U440 (Start-68)
      • expression tag (2-6)
    Domains in SCOPe 2.04: d1ryqa_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ryqA (A:)
    ahhhhhhgssekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakv
    pgkyairvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ryqA (A:)
    hhhhhekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakvpgkya
    irvr