PDB entry 1ryo

View 1ryo on RCSB PDB site
Description: Human serum transferrin, N-lobe bound with oxalate
Class: metal transport
Keywords: Iron transport, METAL TRANSPORT
Deposited on 2003-12-22, released 2004-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.221
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serotransferrin
    Species: Homo sapiens [TaxId:9606]
    Gene: TF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ryoa_
  • Heterogens: OXL, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ryoA (A:)
    vpdktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadav
    tldaglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkscht
    glgrsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcs
    tlnqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykd
    chlaqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsah
    gflkvpprmdakmylgyeyvtairnlr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ryoA (A:)
    ktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtld
    aglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtglg
    rsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstln
    qyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdchl
    aqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgfl
    kvpprmdakmylgyeyvtairnlr