PDB entry 1ryi

View 1ryi on RCSB PDB site
Description: structure of glycine oxidase with bound inhibitor glycolate
Class: oxidoreductase
Keywords: flavoprotein; oxidase; protein-inhibitor complex, oxidoreductase
Deposited on 2003-12-22, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycine oxidase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: GOXB, BSU11670
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ryia1, d1ryia2
  • Chain 'B':
    Compound: glycine oxidase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: GOXB, BSU11670
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ryib1, d1ryib2
  • Chain 'C':
    Compound: glycine oxidase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: GOXB, BSU11670
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ryic1, d1ryic2
  • Chain 'D':
    Compound: glycine oxidase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: GOXB, BSU11670
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ryid1, d1ryid2
  • Heterogens: FAD, GOA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ryiA (A:)
    mhhhhhhmariramkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaa
    gmlgahaeceerdaffdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlq
    lrqmddldsvswyskeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgae
    ifehtpvlhverdgealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaflpvkgecl
    svwnddipltktlyhdhcyivprksgrlvvgatmkpgdwsetpdlgglesvmkkaktmlp
    aiqnmkvdrfwaglrpgtkdgkpyigrhpedsrilfaaghfrngillapatgalisdlim
    nkevnqdwlhafridrkeavni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ryiA (A:)
    mkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaagmlgahaeceerd
    affdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlqlrqmddldsvswy
    skeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgaeifehtpvlhverd
    gealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaflpvkgeclsvwnddipltktl
    yhdhcyivprksgrlvvgatmkpgdwsetpdlgglesvmkkaktmlpaiqnmkvdrfwag
    lrpgtkdgkpyigrhpedsrilfaaghfrngillapatgalisdlimnkevnqdwlhafr
    idrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ryiB (B:)
    mhhhhhhmariramkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaa
    gmlgahaeceerdaffdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlq
    lrqmddldsvswyskeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgae
    ifehtpvlhverdgealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaflpvkgecl
    svwnddipltktlyhdhcyivprksgrlvvgatmkpgdwsetpdlgglesvmkkaktmlp
    aiqnmkvdrfwaglrpgtkdgkpyigrhpedsrilfaaghfrngillapatgalisdlim
    nkevnqdwlhafridrkeavni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ryiB (B:)
    mkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaagmlgahaeceerd
    affdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlqlrqmddldsvswy
    skeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgaeifehtpvlhverd
    gealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaflpvkgeclsvwnddipltktl
    yhdhcyivprksgrlvvgatmkpgdwsetpdlgglesvmkkaktmlpaiqnmkvdrfwag
    lrpgtkdgkpyigrhpedsrilfaaghfrngillapatgalisdlimnkevnqdwlhafr
    idrk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ryiC (C:)
    mhhhhhhmariramkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaa
    gmlgahaeceerdaffdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlq
    lrqmddldsvswyskeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgae
    ifehtpvlhverdgealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaflpvkgecl
    svwnddipltktlyhdhcyivprksgrlvvgatmkpgdwsetpdlgglesvmkkaktmlp
    aiqnmkvdrfwaglrpgtkdgkpyigrhpedsrilfaaghfrngillapatgalisdlim
    nkevnqdwlhafridrkeavni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ryiC (C:)
    mkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaagmlgahaeceerd
    affdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlqlrqmddldsvswy
    skeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgaeifehtpvlhverd
    gealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaflpvkgeclsvwnddipltktl
    yhdhcyivprksgrlvvgatmkpgdwsetpdlgglesvmkkaktmlpaiqnmkvdrfwag
    lrpgtkdgkpyigrhpedsrilfaaghfrngillapatgalisdlimnkevnqdwlhafr
    idrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ryiD (D:)
    mhhhhhhmariramkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaa
    gmlgahaeceerdaffdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlq
    lrqmddldsvswyskeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgae
    ifehtpvlhverdgealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaflpvkgecl
    svwnddipltktlyhdhcyivprksgrlvvgatmkpgdwsetpdlgglesvmkkaktmlp
    aiqnmkvdrfwaglrpgtkdgkpyigrhpedsrilfaaghfrngillapatgalisdlim
    nkevnqdwlhafridrkeavni
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ryiD (D:)
    mkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaagmlgahaeceerd
    affdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlqlrqmddldsvswy
    skeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgaeifehtpvlhverd
    gealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaflpvkgeclsvwnddipltktl
    yhdhcyivprksgrlvvgatmkpgdwsetpdlgglesvmkkaktmlpaiqnmkvdrfwag
    lrpgtkdgkpyigrhpedsrilfaaghfrngillapatgalisdlimnkevnqdwlhafr
    idrk