PDB entry 1ryf

View 1ryf on RCSB PDB site
Description: Alternative Splicing of Rac1 Generates Rac1b, a Self-activating GTPase
Deposited on 2003-12-22, released 2004-01-27
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-10, with a file datestamp of 2004-02-10.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.19
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ryfa_
  • Chain 'B':
    Domains in SCOP 1.67: d1ryfb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ryfA (A:)
    gsmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdt
    agqedydrlrplsypqtvgetygkditsrgkdkpiadvflicfslvspasfenvrakwyp
    evrhhcpntpiilvgtkldlrddkdtieklkekkltpitypqglamakeigavkylecsa
    ltqrglktvfdeairavlcpppv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ryfA (A:)
    gsmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdt
    aiadvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrddkdtieklkek
    kltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpppv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ryfB (B:)
    gsmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdt
    agqedydrlrplsypqtvgetygkditsrgkdkpiadvflicfslvspasfenvrakwyp
    evrhhcpntpiilvgtkldlrddkdtieklkekkltpitypqglamakeigavkylecsa
    ltqrglktvfdeairavlcpppv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ryfB (B:)
    gsmqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdt
    iadvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrddkdtieklkekk
    ltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp