PDB entry 1ryd

View 1ryd on RCSB PDB site
Description: Crystal Structure of Glucose-Fructose Oxidoreductase from Zymomonas mobilis
Class: Oxidoreductase
Keywords: Oxidoreductase, Glucose, Fructose, NADP, Zymomonas mobilis
Deposited on 2003-12-22, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.204
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ryda1, d1ryda2
  • Chain 'B':
    Compound: glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rydb1, d1rydb2
  • Heterogens: GLC, ACT, NDP, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rydA (A:)
    hhhhhhatlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagc
    qhsriealvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaef
    airafkagkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavkliren
    qlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievr
    aytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpat
    gyyqnlisvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvr
    liqaiyeaartgrpvntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rydA (A:)
    atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
    alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
    agkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklg
    mvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysd
    pnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnl
    isvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiy
    eaartgrpvntdwgyvrqggy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rydB (B:)
    hhhhhhatlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagc
    qhsriealvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaef
    airafkagkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavkliren
    qlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievr
    aytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpat
    gyyqnlisvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvr
    liqaiyeaartgrpvntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rydB (B:)
    atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
    alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
    agkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklg
    mvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysd
    pnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnl
    isvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiy
    eaartgrpvntdwgyvrqggy