PDB entry 1ryc

View 1ryc on RCSB PDB site
Description: cytochrome c peroxidase w191g from saccharomyces cerevisiae
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1996-05-10, released 1996-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.163
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (Start-293)
      • conflict (52)
      • conflict (151)
      • engineered (190)
    Domains in SCOPe 2.06: d1ryca_
  • Heterogens: HEM, BZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rycA (A:)
    mktlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rycA (A:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
    nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
    ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl