PDB entry 1rya

View 1rya on RCSB PDB site
Description: Crystal Structure of the E. coli GDP-mannose mannosyl hydrolase in complex with GDP and MG
Class: hydrolase
Keywords: GDP-mannose, mannose, GDP-glucose, NUDIX, Nudix Mg-complex, HYDROLASE
Deposited on 2003-12-20, released 2004-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-mannose mannosyl hydrolase
    Species: Escherichia coli [TaxId:562]
    Gene: NUDD, WCAH, GMM, B2051
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ryaa_
  • Chain 'B':
    Compound: GDP-mannose mannosyl hydrolase
    Species: Escherichia coli [TaxId:562]
    Gene: NUDD, WCAH, GMM, B2051
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ryab_
  • Heterogens: MG, GDP, TRS, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ryaA (A:)
mmflrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetle
aaferltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeelllp
deqhddyrwltsdallasdnvhansrayflaekrtgvpgl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ryaB (B:)
mmflrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetle
aaferltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvseeelllp
deqhddyrwltsdallasdnvhansrayflaekrtgvpgl