PDB entry 1ry8

View 1ry8 on RCSB PDB site
Description: prostaglandin f synthase complexed with nadph and rutin
Deposited on 2003-12-19, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-02, with a file datestamp of 2004-11-02.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.205
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ry8a_
  • Chain 'B':
    Domains in SCOP 1.71: d1ry8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ry8A (A:)
    mdskqqcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeq
    vglairskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspm
    slkpgeelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkp
    glkykpvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpv
    lcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgld
    rnlhyfnsdsfashpnypysdey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ry8A (A:)
    qqcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvgla
    irskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkp
    geelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglky
    kpvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcal
    akkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlh
    yfnsdsfashpnypysdey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ry8B (B:)
    mdskqqcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeq
    vglairskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspm
    slkpgeelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkp
    glkykpvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpv
    lcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgld
    rnlhyfnsdsfashpnypysdey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ry8B (B:)
    qqcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvgla
    irskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkp
    geelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglky
    kpvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcal
    akkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlh
    yfnsdsfashpnypysdey