PDB entry 1ry8

View 1ry8 on RCSB PDB site
Description: Prostaglandin F synthase complexed with NADPH and rutin
Class: oxidoreductase
Keywords: Prostaglandin F synthase, AKR1C3, rutin, OXIDOREDUCTASE
Deposited on 2003-12-19, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldo-keto reductase family 1 member C3
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1C3, DDH1, PGFS, KIAA0119
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ry8a_
  • Chain 'B':
    Compound: Aldo-keto reductase family 1 member C3
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1C3, DDH1, PGFS, KIAA0119
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ry8b_
  • Heterogens: NDP, RUT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ry8A (A:)
    mdskqqcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeq
    vglairskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspm
    slkpgeelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkp
    glkykpvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpv
    lcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgld
    rnlhyfnsdsfashpnypysdey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ry8A (A:)
    qqcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvgla
    irskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkp
    geelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglky
    kpvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcal
    akkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlh
    yfnsdsfashpnypysdey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ry8B (B:)
    mdskqqcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeq
    vglairskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspm
    slkpgeelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkp
    glkykpvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpv
    lcalakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgld
    rnlhyfnsdsfashpnypysdey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ry8B (B:)
    qqcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvgla
    irskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkp
    geelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglky
    kpvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcal
    akkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlh
    yfnsdsfashpnypysdey