PDB entry 1ry7

View 1ry7 on RCSB PDB site
Description: Crystal Structure of the 3 Ig form of FGFR3c in complex with FGF1
Class: growth factor/growth factor receptor
Keywords: FGF-FGFR Complex; beta trefoil; Ig domain, GROWTH FACTOR/GROWTH FACTOR RECEPTOR COMPLEX
Deposited on 2003-12-19, released 2004-02-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.277
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ry7a_
  • Chain 'B':
    Compound: Fibroblast growth factor receptor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR3c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ry7b1, d1ry7b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ry7A (A:)
    maegeittftaltekfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlq
    lsaesvgevyikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaek
    nwfvglkkngsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ry7A (A:)
    eittftaltekfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsae
    svgevyikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfv
    glkkngsckrgprthygqkailflplpvssd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ry7B (B:)
    mgraaevpgpepgqqeqlvfgsgdavelscpppgggpmgptvwvkdgtglvpservlvgp
    qrlqvlnashedsgayscrqrltqrvlchfsvrvtdapssgddedgedeaedtgvdtgap
    ywtrpermdkkllavpaantvrfrcpaagnptpsiswlkngrefrgehriggiklrhqqw
    slvmesvvpsdrgnytcvvenkfgsirqtytldvlersphrpilqaglpanqtavlgsdv
    efhckvysdaqphiqwlkhvevngskvgpdgtpyvtvlktaganttdkelevlslhnvtf
    edageytclagnsigfshhsawlvvlpaeeelve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ry7B (B:)
    apywtrpermdkkllavpaantvrfrcpaagnptpsiswlkngrefrgehriggiklrhq
    qwslvmesvvpsdrgnytcvvenkfgsirqtytldvlersphrpilqaglpanqtavlgs
    dvefhckvysdaqphiqwlkhvevngskvgpdgtpyvtvlktaganttdkelevlslhnv
    tfedageytclagnsigfshhsawlvvlpaeee