PDB entry 1ry7

View 1ry7 on RCSB PDB site
Description: Crystal Structure of the 3 Ig form of FGFR3c in complex with FGF1
Deposited on 2003-12-19, released 2004-02-10
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-10, with a file datestamp of 2004-02-10.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.277
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ry7A (A:)
    maegeittftaltekfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlq
    lsaesvgevyikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaek
    nwfvglkkngsckrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ry7A (A:)
    eittftaltekfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsae
    svgevyikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfv
    glkkngsckrgprthygqkailflplpvssd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ry7B (B:)
    mgraaevpgpepgqqeqlvfgsgdavelscpppgggpmgptvwvkdgtglvpservlvgp
    qrlqvlnashedsgayscrqrltqrvlchfsvrvtdapssgddedgedeaedtgvdtgap
    ywtrpermdkkllavpaantvrfrcpaagnptpsiswlkngrefrgehriggiklrhqqw
    slvmesvvpsdrgnytcvvenkfgsirqtytldvlersphrpilqaglpanqtavlgsdv
    efhckvysdaqphiqwlkhvevngskvgpdgtpyvtvlktaganttdkelevlslhnvtf
    edageytclagnsigfshhsawlvvlpaeeelve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ry7B (B:)
    apywtrpermdkkllavpaantvrfrcpaagnptpsiswlkngrefrgehriggiklrhq
    qwslvmesvvpsdrgnytcvvenkfgsirqtytldvlersphrpilqaglpanqtavlgs
    dvefhckvysdaqphiqwlkhvevngskvgpdgtpyvtvlktaganttdkelevlslhnv
    tfedageytclagnsigfshhsawlvvlpaeee