PDB entry 1ry4

View 1ry4 on RCSB PDB site
Description: NMR Structure of the CRIB-PDZ module of Par-6
Class: cell adhesion
Keywords: PDZ, CRIB, Cdc-42, Cell Polarization, Polarity adaptor complex, CELL ADHESION
Deposited on 2003-12-19, released 2004-03-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cg5884-pa
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Par-6
    Database cross-references and differences (RAF-indexed):
    • GB NP_573238 (2-127)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1ry4a1, d1ry4a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ry4A (A:)
    gsktkapsisiphdfrqvsaiidvdivpethrrvrllkhgsdkplgfyirdgtsvrvtas
    glekqpgifisrlvpgglaestgllavndevievngievagktldqvtdmmvanssnlii
    tvkpanqr