PDB entry 1ry4

View 1ry4 on RCSB PDB site
Description: nmr structure of the crib-pdz module of par-6
Deposited on 2003-12-19, released 2004-03-23
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-23, with a file datestamp of 2004-03-23.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ry4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ry4A (A:)
    gsktkapsisiphdfrqvsaiidvdivpethrrvrllkhgsdkplgfyirdgtsvrvtas
    glekqpgifisrlvpgglaestgllavndevievngievagktldqvtdmmvanssnlii
    tvkpanqr