PDB entry 1ry2

View 1ry2 on RCSB PDB site
Description: Crystal structure of yeast acetyl-coenzyme A synthetase in complex with AMP
Class: ligase
Keywords: amp forming; related to firefly luciferase, LIGASE
Deposited on 2003-12-19, released 2004-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl-coenzyme A synthetase 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ry2a_
  • Heterogens: AMP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ry2A (A:)
    mgsshhhhhhssglvprgshmglqdyqrlhkesiedpakffgskatqflnwskpfdkvfi
    pdpktgrpsfqnnawflngqlnacyncvdrhalktpnkkaiifegdepgqgysitykell
    eevcqvaqvltysmgvrkgdtvavympmvpeaiitllaisrigaihsvvfagfssnslrd
    rindgdskvvittdesnrggkvietkrivddalretpgvrhvlvyrktnnpsvafhaprd
    ldwatekkkyktyypctpvdsedplfllytsgstgapkgvqhstagyllgalltmrytfd
    thqedvfftagdigwitghtyvvygpllygcatlvfegtpaypnysrywdiidehkvtqf
    yvaptalrllkragdsyienhslkslrclgsvgepiaaevwewysekigkneipivdtyw
    qtesgshlvtplaggvtpmkpgsasfpffgidavvldpntgeelntshaegvlavkaawp
    sfartiwknhdryldtylnpypgyyftgdgaakdkdgyiwilgrvddvvnvsghrlstae
    ieaaiiedpivaecavvgfnddltgqavaafvvlknksswstatddelqdikkhlvftvr
    kdigpfaapkliilvddlpktrsgkimrrilrkilagesdqlgdvstlsnpgivrhlids
    vkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ry2A (A:)
    qdyqrlhkesiedpakffgskatqflnwskpfdkvfipdpktgrpsfqnnawflngqlna
    cyncvdrhalktpnkkaiifegdepgqgysitykelleevcqvaqvltysmgvrkgdtva
    vympmvpeaiitllaisrigaihsvvfagfssnslrdrindgdskvvittdesnrggkvi
    etkrivddalretpgvrhvlvyrktnnpsvafhaprdldwatekkkyktyypctpvdsed
    plfllytsgstgapkgvqhstagyllgalltmrytfdthqedvfftagdigwitghtyvv
    ygpllygcatlvfegtpaypnysrywdiidehkvtqfyvaptalrllkragdsyienhsl
    kslrclgsvgepiaaevwewysekigkneipivdtywqtesgshlvtplaggvtpmkpgs
    asfpffgidavvldpntgeelntshaegvlavkaawpsfartiwknhdryldtylnpypg
    yyftgdgaakdkdgyiwilgrvddvvnvsghrlstaeieaaiiedpivaecavvgfnddl
    tgqavaafvvlklqdikkhlvftvrkdigpfaapkliilvddlpktrsgkimrrilrkil
    anpgivrhlidsvkl