PDB entry 1rxz

View 1rxz on RCSB PDB site
Description: C-terminal region of A. fulgidus FEN-1 complexed with A. fulgidus PCNA
Class: replication
Keywords: beta-zipper, interdomain connecting loop, DNA repair, DNA replication
Deposited on 2003-12-18, released 2004-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase sliding clamp
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: PCN, AF0335
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rxza1, d1rxza2
  • Chain 'B':
    Compound: Flap structure-specific endonuclease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rxzA (A:)
    midvimtgellktvtraivalvsearihflekglhsravdpanvamvivdipkdsfevyn
    ideektigvdmdrifdisksistkdlvelivedestlkvkfgsveykvalidpsairkep
    ripelelpakivmdagefkkaiaaadkisdqvifrsdkegfrieakgdvdsivfhmtete
    liefnggearsmfsvdylkefckvagsgdlltihlgtnypvrlvfelvggrakveyilap
    riese
    

  • Chain 'B':
    No sequence available.