PDB entry 1rxx

View 1rxx on RCSB PDB site
Description: Structure of arginine deiminase
Class: hydrolase
Keywords: arginine degradation pathway, L-arginine deiminase, catalytic mechanism, Structure 2 Function Project, S2F, Structural Genomics, HYDROLASE
Deposited on 2003-12-18, released 2004-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.198
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginine deiminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: ARCA, PA5171
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981
      • modified residue (23)
      • modified residue (64)
      • modified residue (74)
      • modified residue (145)
      • modified residue (182)
      • modified residue (231)
      • modified residue (242)
      • modified residue (279)
      • modified residue (318)
      • modified residue (409)
    Domains in SCOPe 2.07: d1rxxa_
  • Chain 'B':
    Compound: Arginine deiminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: ARCA, PA5171
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981 (Start-420)
      • modified residue (23)
      • modified residue (64)
      • modified residue (74)
      • modified residue (145)
      • modified residue (182)
      • modified residue (231)
      • modified residue (242)
      • modified residue (279)
      • modified residue (318)
      • modified residue (409)
    Domains in SCOPe 2.07: d1rxxb_
  • Chain 'C':
    Compound: Arginine deiminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: ARCA, PA5171
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981 (Start-420)
      • modified residue (23)
      • modified residue (64)
      • modified residue (74)
      • modified residue (145)
      • modified residue (182)
      • modified residue (231)
      • modified residue (242)
      • modified residue (279)
      • modified residue (318)
      • modified residue (409)
    Domains in SCOPe 2.07: d1rxxc_
  • Chain 'D':
    Compound: Arginine deiminase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: ARCA, PA5171
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13981
      • modified residue (23)
      • modified residue (64)
      • modified residue (74)
      • modified residue (145)
      • modified residue (182)
      • modified residue (231)
      • modified residue (242)
      • modified residue (279)
      • modified residue (318)
      • modified residue (409)
    Domains in SCOPe 2.07: d1rxxd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rxxA (A:)
    gshmstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfd
    fvtkmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswleslepr
    klaeyliggvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtl
    npmywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvl
    igmgerssrqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpev
    vkeivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwdd
    gnnvvclepgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpid
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxxA (A:)
    tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
    gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
    gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
    rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
    rqaigqvaqslfakgaaervivaglpkaamhldtvfsfcdrdlvtvfpevvkeivpfslr
    pdpsspygmnirreektflevvaeslglkklrvvetggnsfereqwddgnnvvclepgvv
    vgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rxxB (B:)
    gshmstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfd
    fvtkmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswleslepr
    klaeyliggvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtl
    npmywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvl
    igmgerssrqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpev
    vkeivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwdd
    gnnvvclepgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpid
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxxB (B:)
    tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
    gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
    gvaaddlpaseganilkmyreylghfllpplpntqftrdttcwiyggvtlnpmywparrq
    etllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerssrq
    aigqvaqslfakgaaervivaglpkaamhldtvfsfcdrdlvtvfpevvkeivpfslrpd
    psspygmnirreektflevvaeslglkklrvvetggnreqwddgnnvvclepgvvvgydr
    ntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rxxC (C:)
    gshmstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfd
    fvtkmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswleslepr
    klaeyliggvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtl
    npmywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvl
    igmgerssrqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpev
    vkeivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwdd
    gnnvvclepgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpid
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxxC (C:)
    tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
    gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
    gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
    rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
    rqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvkeivpfs
    lrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaeeqwddgnnvvclep
    gvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rxxD (D:)
    gshmstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfd
    fvtkmrergidvlemhnlltetiqnpealkwildrkitadsvglgltselrswleslepr
    klaeyliggvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtl
    npmywparrqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvl
    igmgerssrqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpev
    vkeivpfslrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwdd
    gnnvvclepgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpid
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxxD (D:)
    tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
    gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
    gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
    rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
    rqaigqvaqslfakgaaervivaglpkaamhldtvfsfcdrdlvtvfpevvkeivpfslr
    pdpsspygmnirreektflevvaeslglkklrvvetgeqwddgnnvvclepgvvvgydrn
    tytntllrkagvevitisaselgrgrggghcmtcpivrdpid