PDB entry 1rxw

View 1rxw on RCSB PDB site
Description: Crystal structure of A. fulgidus FEN-1 bound to DNA
Class: hydrolase/DNA
Keywords: helical clamp, helix-3 turn-helix, hydrophobic wedge, 3' flap binding site
Deposited on 2003-12-18, released 2004-01-27
The last revision prior to the SCOP 1.73 freeze date was dated 2004-01-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.242
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flap structure-specific endonuclease
    Species: Archaeoglobus fulgidus
    Gene: FEN, AF0264
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rxwa1, d1rxwa2
  • Chain 'B':
    Compound: 5'-d(*C*pG*pA*pT*pG*pC*pT*pA)-3'
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: 5'-d(*T*pA*pG*pC*pA*pT*pC*pG*pG)-3'
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rxwA (A:)
    mgadigdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsg
    ilyrvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkya
    qaagrvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgs
    prlarnlaitgkrklpgknvyvdvkpeiiilesnlkrlgltreqlidiailvgtdynegv
    kgvgvkkalnyiktygdifralkalkvnidhveeirnfflnppvtddyriefrepdfeka
    ieflceehdfsrervekaleklkalkstqatlerwf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxwA (A:)
    adigdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsgil
    yrvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkyaqa
    agrvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgspr
    larnlaidvkpeiiilesnlkrlgltreqlidiailvgtdynegvkgvgvkkalnyikty
    gdifralkalkvveeirnfflnppvtddyriefrepdfekaieflceehdfsrervekal
    eklka
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.