PDB entry 1rxv

View 1rxv on RCSB PDB site
Description: Crystal Structure of A. Fulgidus FEN-1 bound to DNA
Class: hydrolase/DNA
Keywords: helical clamp, helix-3 turn-helix, 3' flap binding site, protein-dna complex, dna repair, dna replication, HYDROLASE/DNA COMPLEX
Deposited on 2003-12-18, released 2004-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.274
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flap structure-specific endonuclease
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: FEN, AF0264
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rxva1, d1rxva2
  • Chain 'B':
    Compound: Flap structure-specific endonuclease
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: FEN, AF0264
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rxvb1, d1rxvb2
  • Chain 'C':
    Compound: 5'-d(*T*pA*pG*pC*pA*pT*pC*pG*pG)
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: 5'-d(*T*pA*pG*pC*pA*pT*pC*pG*pG)
    Species: synthetic, synthetic

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rxvA (A:)
    mgadigdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsg
    ilyrvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkya
    qaagrvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgs
    prlarnlaitgkrklpgknvyvdvkpeiiilesnlkrlgltreqlidiailvgtdynegv
    kgvgvkkalnyiktygdifralkalkvnidhveeirnfflnppvtddyriefrepdfeka
    ieflceehdfsrervekaleklkalkstqatlerwf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxvA (A:)
    digdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsgily
    rvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkyaqaa
    grvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgsprl
    arnlaikpeiiilesnlkrlgltreqlidiailvgtdynegvkgvgvkkalnyiktygdi
    fralkalkvnidhveeirnfflnppvtddyriefrepdfekaieflceehdfsrerveka
    leklk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rxvB (B:)
    mgadigdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsg
    ilyrvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkya
    qaagrvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgs
    prlarnlaitgkrklpgknvyvdvkpeiiilesnlkrlgltreqlidiailvgtdynegv
    kgvgvkkalnyiktygdifralkalkvnidhveeirnfflnppvtddyriefrepdfeka
    ieflceehdfsrervekaleklkalkstqatlerwf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxvB (B:)
    digdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsgily
    rvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkyaqaa
    grvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgsprl
    arnlaikpeiiilesnlkrlgltreqlidiailvgtdynegvkgvgvkkalnyiktygdi
    fralkalkvnidhveeirnfflnppvtddyriefrepdfekaieflceehdfsrerveka
    leklk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.