PDB entry 1rxv

View 1rxv on RCSB PDB site
Description: Crystal Structure of A. Fulgidus FEN-1 bound to DNA
Deposited on 2003-12-18, released 2004-01-27
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.274
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rxvA (A:)
    mgadigdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsg
    ilyrvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkya
    qaagrvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgs
    prlarnlaitgkrklpgknvyvdvkpeiiilesnlkrlgltreqlidiailvgtdynegv
    kgvgvkkalnyiktygdifralkalkvnidhveeirnfflnppvtddyriefrepdfeka
    ieflceehdfsrervekaleklkalkstqatlerwf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxvA (A:)
    digdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsgily
    rvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkyaqaa
    grvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgsprl
    arnlaikpeiiilesnlkrlgltreqlidiailvgtdynegvkgvgvkkalnyiktygdi
    fralkalkvnidhveeirnfflnppvtddyriefrepdfekaieflceehdfsrerveka
    leklk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rxvB (B:)
    mgadigdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsg
    ilyrvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkya
    qaagrvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgs
    prlarnlaitgkrklpgknvyvdvkpeiiilesnlkrlgltreqlidiailvgtdynegv
    kgvgvkkalnyiktygdifralkalkvnidhveeirnfflnppvtddyriefrepdfeka
    ieflceehdfsrervekaleklkalkstqatlerwf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxvB (B:)
    digdlfereeveleyfsgkkiavdafntlyqfisiirqpdgtplkdsqgritshlsgily
    rvsnmvevgirpvfvfdgeppefkkaeieerkkrraeaeemwiaalqagdkdakkyaqaa
    grvdeyivdsaktllsymgipfvdapsegeaqaaymaakgdveytgsqdydsllfgsprl
    arnlaikpeiiilesnlkrlgltreqlidiailvgtdynegvkgvgvkkalnyiktygdi
    fralkalkvnidhveeirnfflnppvtddyriefrepdfekaieflceehdfsrerveka
    leklk