PDB entry 1rxt

View 1rxt on RCSB PDB site
Description: Crystal structure of human myristoyl-CoA:protein N-myristoyltransferase.
Class: transferase
Keywords: alpha-beta structure; unique N-myristoyltransferase fold
Deposited on 2003-12-18, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.283
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycylpeptide N-tetradecanoyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30419 (Start-495)
      • conflict (492)
    Domains in SCOPe 2.07: d1rxta1, d1rxta2
  • Chain 'B':
    Compound: Glycylpeptide N-tetradecanoyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30419 (Start-495)
      • conflict (492)
    Domains in SCOPe 2.07: d1rxtb1, d1rxtb2
  • Chain 'C':
    Compound: Glycylpeptide N-tetradecanoyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30419 (Start-495)
      • conflict (492)
    Domains in SCOPe 2.07: d1rxtc1, d1rxtc2
  • Chain 'D':
    Compound: Glycylpeptide N-tetradecanoyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30419 (Start-495)
      • conflict (492)
    Domains in SCOPe 2.07: d1rxtd1, d1rxtd2
  • Heterogens: CO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rxtA (A:)
    madesetavkppapplpqmmegngnghehcsdceneednsynrgglspandtgakkkkkk
    qkkkkekgsetdsaqdqpvkmnslpaeriqeiqkaielfsvgqgpaktmeeaskrsyqfw
    dtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelytllneny
    vedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanihiydtek
    kmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtcrywhrs
    lnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltrylkqf
    hltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthkslkaay
    sfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlqyylyn
    wkcpsmgaekvgivlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxtA (A:)
    gftwdaldlgdrgvlkelytllnenyvedddnmfrfdyspefllwalrppgwlpqwhcgv
    rvvssrklvgfisaipanihiydtekkmveinflcvhkklrskrvapvlireitrrvhle
    gifqavytagvvlpkpvgtcrywhrslnprklievkfshlsrnmtmqrtmklyrlpetpk
    taglrpmetkdipvvhqlltrylkqfhltpvmsqeevehwfypqeniidtfvvenangev
    tdflsfytlpstimnhpthkslkaaysfynvhtqtplldlmsdalvlakmkgfdvfnald
    lmenktfleklkfgigdgnlqyylynwkcpsmgaekvgivlq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rxtB (B:)
    madesetavkppapplpqmmegngnghehcsdceneednsynrgglspandtgakkkkkk
    qkkkkekgsetdsaqdqpvkmnslpaeriqeiqkaielfsvgqgpaktmeeaskrsyqfw
    dtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelytllneny
    vedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanihiydtek
    kmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtcrywhrs
    lnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltrylkqf
    hltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthkslkaay
    sfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlqyylyn
    wkcpsmgaekvgivlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxtB (B:)
    gftwdaldlgdrgvlkelytllnenyvedddnmfrfdyspefllwalrppgwlpqwhcgv
    rvvssrklvgfisaipanihiydtekkmveinflcvhkklrskrvapvlireitrrvhle
    gifqavytagvvlpkpvgtcrywhrslnprklievkfshlsrnmtmqrtmklyrlpetpk
    taglrpmetkdipvvhqlltrylkqfhltpvmsqeevehwfypqeniidtfvvenangev
    tdflsfytlpstimnhpthkslkaaysfynvhtqtplldlmsdalvlakmkgfdvfnald
    lmenktfleklkfgigdgnlqyylynwkcpsmgaekvgivlq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rxtC (C:)
    madesetavkppapplpqmmegngnghehcsdceneednsynrgglspandtgakkkkkk
    qkkkkekgsetdsaqdqpvkmnslpaeriqeiqkaielfsvgqgpaktmeeaskrsyqfw
    dtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelytllneny
    vedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanihiydtek
    kmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtcrywhrs
    lnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltrylkqf
    hltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthkslkaay
    sfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlqyylyn
    wkcpsmgaekvgivlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxtC (C:)
    dlgdrgvlkelytllnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrgfisai
    panihiydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpk
    pvgtcrywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvv
    hqlltrylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimn
    thkslkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigd
    gnlqyylynwkcpsmgaekvgivlq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rxtD (D:)
    madesetavkppapplpqmmegngnghehcsdceneednsynrgglspandtgakkkkkk
    qkkkkekgsetdsaqdqpvkmnslpaeriqeiqkaielfsvgqgpaktmeeaskrsyqfw
    dtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelytllneny
    vedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanihiydtek
    kmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtcrywhrs
    lnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvhqlltrylkqf
    hltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnhpthkslkaay
    sfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgigdgnlqyylyn
    wkcpsmgaekvgivlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxtD (D:)
    dlgdrgvlkelytllnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvgfisaip
    anihiydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkp
    vgtcrywhrslnprklievkfshlsrnmtmqrtmklyrlpetpktaglrpmetkdipvvh
    qlltrylkqfhltpvmsqeevehwfypqeniidtfvvenangevtdflsfytlpstimnh
    pthkslkaaysfynvhtqtplldlmsdalvlakmkgfdvfnaldlmenktfleklkfgig
    dgnlqyylynwkcpsmgaekvgivlq