PDB entry 1rxr

View 1rxr on RCSB PDB site
Description: high resolution solution structure of the retinoid x receptor DNA binding domain, nmr, 20 structure
Class: transcription factor
Keywords: transcription factor, nuclear hormone receptor, zinc-finger
Deposited on 1998-06-12, released 1998-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: retinoic acid receptor-alpha
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19793 (0-82)
    • mutation (65)
  Domains in SCOPe 2.07: d1rxra_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rxrA (A:)
  ftkhicaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqy
  cryqkalamgmkreavqeerqrg