PDB entry 1rxr

View 1rxr on RCSB PDB site
Description: high resolution solution structure of the retinoid x receptor dna binding domain, nmr, 20 structure
Deposited on 1998-06-12, released 1998-11-11
The last revision prior to the SCOP 1.59 freeze date was dated 1998-11-11, with a file datestamp of 1998-11-11.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1rxr__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rxr_ (-)
  ftkhicaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqy
  cryqkalamgmkreavqeerqrg