PDB entry 1rxq

View 1rxq on RCSB PDB site
Description: YfiT from Bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology
Deposited on 2003-12-18, released 2004-07-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-20, with a file datestamp of 2004-07-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.188
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1rxqa_
  • Chain 'B':
    Domains in SCOP 1.69: d1rxqb_
  • Chain 'C':
    Domains in SCOP 1.69: d1rxqc_
  • Chain 'D':
    Domains in SCOP 1.69: d1rxqd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rxqA (A:)
    mtsvnlsypigeykpresiskeqkdkwiqvleevpaklkqavevmtdsqldtpyrdggwt
    vrqvvhhladshmnsyirfklslteetpairpydekawselkdsktadpsgslallqelh
    grwtallrtltdqqfkrgfyhpdtkeiitlenalglyvwhshhhiahitelsrrmgws
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxqA (A:)
    nlsypigeykpresiskeqkdkwiqvleevpaklkqavevmtdsqldtpyrdggwtvrqv
    vhhladshmnsyirfklslteetpairpydekawselkdsktadpsgslallqelhgrwt
    allrtltdqqfkrgfyhpdtkeiitlenalglyvwhshhhiahitelsrrmgws
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rxqB (B:)
    mtsvnlsypigeykpresiskeqkdkwiqvleevpaklkqavevmtdsqldtpyrdggwt
    vrqvvhhladshmnsyirfklslteetpairpydekawselkdsktadpsgslallqelh
    grwtallrtltdqqfkrgfyhpdtkeiitlenalglyvwhshhhiahitelsrrmgws
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxqB (B:)
    vnlsypigeykpresiskeqkdkwiqvleevpaklkqavevmtdsqldtpyrdggwtvrq
    vvhhladshmnsyirfklslteetpairpydekawselkdsktadpsgslallqelhgrw
    tallrtltdqqfkrgfyhpdtkeiitlenalglyvwhshhhiahitelsrrmgws
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rxqC (C:)
    mtsvnlsypigeykpresiskeqkdkwiqvleevpaklkqavevmtdsqldtpyrdggwt
    vrqvvhhladshmnsyirfklslteetpairpydekawselkdsktadpsgslallqelh
    grwtallrtltdqqfkrgfyhpdtkeiitlenalglyvwhshhhiahitelsrrmgws
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxqC (C:)
    nlsypigeykpresiskeqkdkwiqvleevpaklkqavevmtdsqldtpyrdggwtvrqv
    vhhladshmnsyirfklslteetpairpydekawselkdsktadpsgslallqelhgrwt
    allrtltdqqfkrgfyhpdtkeiitlenalglyvwhshhhiahitelsrrmgws
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rxqD (D:)
    mtsvnlsypigeykpresiskeqkdkwiqvleevpaklkqavevmtdsqldtpyrdggwt
    vrqvvhhladshmnsyirfklslteetpairpydekawselkdsktadpsgslallqelh
    grwtallrtltdqqfkrgfyhpdtkeiitlenalglyvwhshhhiahitelsrrmgws
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxqD (D:)
    igeykpresiskeqkdkwiqvleevpaklkqavevmtdsqldtpyrdggwtvrqvvhhla
    dshmnsyirfklslteetpairpydekawselkdsktadpsgslallqelhgrwtallrt
    ltdqqfkrgfyhpdtkeiitlenalglyvwhshhhiahitelsrrmgws