PDB entry 1rxm

View 1rxm on RCSB PDB site
Description: C-terminal region of FEN-1 bound to A. fulgidus PCNA
Class: replication
Keywords: sliding clamp, torus, processivity factor, beta-zipper, hydrophobic anchor, REPLICATION
Deposited on 2003-12-18, released 2004-01-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.205
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase sliding clamp
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: PCN, AF0335
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1rxma1, d1rxma2
  • Chain 'B':
    Compound: consensus FEN-1 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1RXM (0-11)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rxmA (A:)
    midvimtgellktvtraivalvsearihflekglhsravdpanvamvivdipkdsfevyn
    ideektigvdmdrifdisksistkdlvelivedestlkvkfgsveykvalidpsairkep
    ripelelpakivmdagefkkaiaaadkisdqvifrsdkegfrieakgdvdsivfhmtete
    liefnggearsmfsvdylkefckvagsgdlltihlgtnypvrlvfelvggrakveyilap
    riese
    

  • Chain 'B':
    No sequence available.