PDB entry 1rxl

View 1rxl on RCSB PDB site
Description: solution structure of the engineered protein afae-dsc
Deposited on 2003-12-18, released 2005-01-11
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-11, with a file datestamp of 2005-01-11.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1rxla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rxlA (A:)
    hhhhhhglvprgseecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalkadtd
    nfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgqqtnt
    ppgnytltltggywakdnkqgftpsgttgttkltvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxlA (A:)
    eecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalkadtdnfeqgkfflisdn
    nrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgqqtntppgnytltltggy
    wakdnkqgftpsgttgttkltvt