PDB entry 1rxl

View 1rxl on RCSB PDB site
Description: Solution structure of the engineered protein Afae-dsc
Class: structural protein
Keywords: AfaE, DAF, Afimbrial sheath, DAEC, UPEC, Ig-like domain, donor strand complemented, STRUCTURAL PROTEIN
Deposited on 2003-12-18, released 2005-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: afimbrial adhesin afa-III
    Species: Escherichia coli [TaxId:562]
    Gene: afae3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57254 (13-135)
      • see remark 999 (136-155)
    Domains in SCOPe 2.07: d1rxla1, d1rxla2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rxlA (A:)
    hhhhhhglvprgseecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalkadtd
    nfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgqqtnt
    ppgnytltltggywakdnkqgftpsgttgttkltvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rxlA (A:)
    eecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalkadtdnfeqgkfflisdn
    nrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgqqtntppgnytltltggy
    wakdnkqgftpsgttgttkltvt