PDB entry 1rxi

View 1rxi on RCSB PDB site
Description: pi258 arsenate reductase (arsc) triple mutant c10s/c15a/c82s
Deposited on 2003-12-18, released 2004-06-01
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-01, with a file datestamp of 2004-06-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.209
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1rxia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rxiA (A:)
    mdkktiyfistgnsarsqmaegwgkeilgegwnvysagiethgvnpkaieamkevdidis
    nhtsdlidndilkqsdlvvtlssdadnncpilppnvkkehwgfddpagkewsefqrvrde
    iklaiekfklr